I have a single column data frame - example data:
1 >PROKKA_00002 Alpha-ketoglutarate permease
2 MTESSITERGAPELADTRRRIWAIVGASSGNLVEWFDFYVYSFCSLYFAHIFFPSGNTTT
3 QLLQTAGVFAAGFLMRPIGGWLFGRIADRRGRKTSMLISVCMMCFGSLVIACLPGYAVIG
4 >PROKKA_00003 lipoprotein
5 MRTIIVIASLLLTGCSHMANDAWSGQDKAQHFLASAMLSAAGNEYAQHQGYSRDRSAAIG
Each sequence of letters is associated with the ">" line above it. I need a two-column data frame with lines starting in ">" in the first column, and the respective lines of letters concatenated as one sequence in the second column. This is what I've tried so far:
y <- matrix(0,5836,2) #empty matrix with 5836 rows and two columns
z <- 0
for(i in 1:nrow(df)){
if((grepl(pattern = "^>", x = df)) == TRUE){ #tried to set the conditional "if a line starts with ">", execute code"
z <- z + 1
y[z,1] <- paste(df[i])
} else{
y[z,2] <- paste(df[i], collapse = "")
}
}
I would eventually convert the matrix y back to a data.frame using as.data.frame, but my loop keeps getting Error: unexpected '}' in "}". I'm also not sure if my conditional is right. Can anyone help? It would be greatly appreciated!